GenomeNet

>tr:Q9I2H0_PSEAE [Q9I2H0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAG05322.1};
MKNAMALTLAGLLAAPSLGFAAAPDAVMVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAK
SEISLKNSCLVAQSAAGQSFRLDTVDEELTADTLKPGASVEGDAIFASEDDAVYGASLVR
LSDRCK

BLAST