GenomeNet

>sp:KITH_VACCT [Q9JFB7] RecName: Full=Thymidine kinase; EC=2.7.1.21;
MNGGHIQLMIGPMFSGKSTELIRRVRRYQIAQYKCVTIKYSNDNRYGTGLWTHDKNNFEA
LEATKLCDVLESITDFSVIGIDEGQFFPDIVEFCERMANEGKIVIVAALDGTFQRKPFNN
ILNLIPLSEMVVKLTAVCMKCFKEASFSKRLGEETEIEIIGGNDMYQSVCRKCYIDS

BLAST