GenomeNet

>tr:Q9R344_BORBU [Q9R344] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAF07635.1};
MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDDGAASSNAITFKNFLDASKDKIFK
GEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSI
SSATLSRSDHLLIMPSSDTIQKTPVPKHILGVPSNLAYGSITRSTTLYPSDYENNAIFIN
MEDNDDVTLIFSKSYDNSPVYLDIEIQVKINDNRMQKKSLKLQYSDETTYNRVYEIAGPR
GLFTRIPIYKGWYVQKRASLYGDPVPDLLKL

BLAST