GenomeNet

>tr:Q9S0F1_BORBU [Q9S0F1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAF07498.1};
MADDQEKLLIDEEETVQIKDLNKVTTVNNTDLLLLDDGAASSNAITFKNFLKTVNHQTFK
GEELGYFKEIIKSTIATELAADKDFIKSIYDLIVDKLIENESSKLSNLFSKIKSRLTDSI
SSATLSRSDDLLIMPSSDTIQKTPVPKHILGVPSNFTYGSITRSTTLYPSDYENKAISIN
MEDNDDVTLIFYKNYDNDPIYLDIEIQVKINDNRMQKKSLKLMYSDEITYNWVYEITGPR
GLFTRTPIYNGWYIQKRASLYGDSVPDLLKL

BLAST