GenomeNet

>sp:SDP6_ARATH [Q9SS48] RecName: Full=Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; EC=1.1.5.3; AltName: Full=Protein SUGAR-DEPENDENT 6; Flags: Precursor;
MSLASIRRLAAGAAVIAAASGGAVYLSPSVASSDKGGGPILDSLRRRLGDPTASVPSRSA
QESALIAATASDPLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVIYFWMG
LKMYDLVAGPRLLHLSRYYSAKESIELFPTLARKGKDKNLRGTVVYYDGQMNDSRLNVGL
ACTAALAGAAVLNHAEVVSLITDDATKRIIGARIRNNLTGQEFNSYAKVVVNAAGPFCDS
IRKMIDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTSITSLPEPHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESISR
DHVVFEENPGLVTITGGKWTTYRSMAEDAVDAAIKSGQLKPTNECVTQKLQLLGSYGWEP
SSFTTLAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGKRLAH
GHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKSR
QKQELQKAKEFLETFKSSKNAQFNDGKHN

BLAST