GenomeNet

>sp:APC10_HUMAN [Q9UM13] RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10; AltName: Full=Cyclosome subunit 10;
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR

BLAST