GenomeNet

>tr:R4KBV4_9FIRM [R4KBV4] SubName: Full=Fe2+ transport system protein B {ECO:0000313|EMBL:AGL00678.1};
MGLTYQSTGQLTTREIFNANTDNCDYVIALAGNPNTGKSTVFNALTGLRQHTGNWPGKTV
QRAEGTYIHKSRRYRLIDLPGTYSLLANSADEEVARDFICFARPDATIVVVDATCLERNL
NLALQVMEITDKVIVCVNLIDEARRKKIQLNTAKLSDRLGVPVVATAARSGEGLSRLMDL
VDDVAMGRILPKPQPVRYSKEVEEAIAQLEPRVRALVGEDINSRWLTLRLLDCDTRLVRT
IENYLNARETAAAVPLAQEGLA

BLAST