GenomeNet

>tr:R5XQ39_9CLOT [R5XQ39] SubName: Full=Putative cell division protein FtsL {ECO:0000313|EMBL:CDA10906.1};
MHNENEKVKSFKAYKRKKKNKNKRGIFKRKTGVLVIILIAAIGVGNLCIYQVSSKLKYQI
YYLEKDLKKQKNKLETLQVEKLGKENTNTLEEDAIEKLNMIYPTDSQKIYISVDD

BLAST