GenomeNet

>tr:R6PWN1_9FIRM [R6PWN1] RecName: Full=Small ribosomal subunit biogenesis GTPase RsgA {ECO:0000256|HAMAP-Rule:MF_01820}; EC=3.6.1.- {ECO:0000256|HAMAP-Rule:MF_01820};
MNGYIVKGIGGFYYVKTAEGIVECKPRGIFRKQKITPVAGDEVTLETENGAAVIAQIAPR
KNVFVRPPVANLDVLFLVASTTQPTPSTLVLDKLSAIAVDKGVQPVIVCTKGDLAEAEFL
RSAYEKSTLPFIRIDYGTGAGLDEVKQWITGRLCAFCGNSGVGKSTLLNALLPDVERETG
AISQKLGRGRHTTREVTIFEAFGGRIADTPGFASLEANRAGFIPKENLEHAFPEFGPYLG
ECQFTGCSHRAEKGCAVRAALAEGKLSQTRYDSYCAMYDEVKDVKDWQRPKV

BLAST