GenomeNet

>tr:R7YR93_CONA1 [R7YR93] RecName: Full=Translation machinery-associated protein 22 {ECO:0000256|RuleBase:RU361273};
MADVADGASASPAKQVIYCGICSLPPEYCEFGGTTKKCEEWLQKNHPAMHERLYSQDAIE
ANLSTLSLDAQKRAAKDAEKKAAKAASAAAKEEERKASSKVIIKRVERNKRKYVTEVSGL
EAFDLDLKKVAKDFGKKFATGSSVTKVPGGGEAITVQGDLSDDIYDYVTENYEQIPEDNV
ECVEDKKKKPAS

BLAST