GenomeNet

>tr:R7ZQD6_9BACT [R7ZQD6] SubName: Full=Competence protein {ECO:0000313|EMBL:EON76325.1};
MLDLLVYKGYFSKNIQPMPFNQFPFLRYVLFFVFGVWIYPYTRDLYVGVWLGAACFLFGC
YLVLLLLDLRIQTRFFSLPLPMLAYGILILSGVGFASLRDSKNDPDHLLHQVAIEGYLAA
VHGVDEPKARSVANKVEVLMINREGQFLPSKGTVLLYHMGELELRPGDLVYIEGQPSRIE
PPINPGEFDYRLFLERQQVYFRHFVRGSIIHLNQKHPLGWRQRVALVRQELSARIDRYLI
DSHANQIANALLLGQKDSMEPTLKEAYATAGAMHILAVSGLHVGIVYGFFFLFWKPQRLP
VIRRSLFLTLVIVLVWGYAVITGLSPSVLRAATMFTLIGLAQMKSRSPSIFNPLALSALL
LVLYDPFVVHAVGFQLSYAALVGILVFQPVIVSWWTPTSKLVDYFWQIASVSVAAQLATF
PLTLHYFNSFPTYFLFSNLLAIPAAFFIMVIGIPFLLFSPIPFLASWLGKLLEGFITVFN
QLMYSIQFLPRARLDNLYMDWVEMVIVWLLIALLFWWLAQRRRLAYQLALLALSILVCYR
FWILFESYKWEEPVIYRLSGGVAVDWFFRGVVYSYEQGVSPEEYRYKVLPNRIQRGYPPS
YPLLGMNSGGGTYLLSPNNEWFFLDPKRGLVRKLVEAGLKGDQTYLPGGPLLSPPAEEYS
D

BLAST