GenomeNet

>tr:R8W1P9_9CLOT [R8W1P9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EOQ38639.1};
MKEYDIKITETLEKTVTVKAESMEAAQAKVEEEYYNSEHILDSENFTGVDFSAEAEREIV
QEQKEQLDVLLVKPGMYPQAVQIGGELEDLQKAVGGDIEAVYPYNEPVALIVNDEGKLNG
SELNRALRDNEGQIYDIVAGDFLVVGLGEENFASLSPELMEKFEKEFHQPEMFVRMGRSI
MALPLPDDKVKAADAPLKSESIPQKSSPDRDVL

BLAST