GenomeNet

>tr:R9B6Z4_9GAMM [R9B6Z4] RecName: Full=N-acetyltransferase domain-containing protein {ECO:0000259|PROSITE:PS51186};
MSDQNQTNLTIGQLLELNQGKNPTQIADTEARARKAAKSLGLDYSKITQTPEEIASVADE
VNTQKRINDVVASDPVLGKYALDPNQAAISLDDFGGLKRVSDSVLLLKPSITEPRQTVDY
NDIQEIFKKGTTPEQKKTLQNLGLYEDPSKQIQPKVPNQHIQELNKPLFPQSIEQTIEQQ
FNEIKKSHGVYAAARFKQYMSNQLYWANNTASAEPVNAEDQGNRYVNATKRGYASIWQTM
GAAKFAVTGDASMLDRFTLYKNKIPQSGEMSQALSDMQLAAQTNDAGVLGAAQEFVKNAD
LGLLAEFTAEQLPPSIAGFALGAGSGNVLSQTLTRSTARYAPVLMNMQRASSVVRGVALA
GSSMEGALGAGAADFVASYGQNMAEAREKFLTKEEQIDYAAAKTWGSAKYSALGGLLLPV
GFGGPMRTVGGQAVIQSAAGMYSVQGAADAVGEQANPVEMALEGVLGLAMSAPEVAIVSA
GKVKNQYTAQLAIDQMYQEQQANAVKSTTFASVLSNLINQNKETKTAQRDEETSQSFIRQ
AVEEHGAVGEVYIDGQTFNQLLRDRDLDPEDLFARAPSLQNQLGDAQEFNSTVQIPIDEF
VSAMSSIEDPSGFVENIRSNPDMPTYLEAQDIFNRTTEQMQAEADVFLNEQAAFEVADDA
REQVATEVQGQLADVGTFNAKYNRAAGELTSAFYSTLGEKLGITAKEAFDRYPIRITNEV
SNNSAEQSATFNQSEMSQQTISLDDFATGLKEKYGIDLGLKGNPKSNFISLHKIIVPETA
RSKGVGSKAMKEILDYADAANKTMILTPSSDFGGNKSRLVDFYKRHGFVENKGRNKDYEI
SETMYRSPFGKKYNQTNGGTRGSITFNIGQDGSTIVLSKNADFSTFVHELGHHFLEMNMQ
LALSPDAPVQIREDMETVLKWAKADFESLNEWDFFTDAEKTEVHEKFAETFEQYVYTGKA
PNADLKQVFNRFRQFMIAVYRNIEKFLGINDRAELSSDITGVMDRMLASESSIKEAEAAY
NLEMLIKQDDSMRLGISPKDYDEMRQDHEAATELAINTLEQKSIQNLSWYQKQKTKYMRT
LQREANKKREAVREEIAKDVAQEPVYQAMAFLRQPSDPKPKTNLKKVEPERDNLFEAIAK
FGGLDANEVESTWGIDQPATIKSGVANQPVVRSSKSKVKGLSIEAMSERLVEEGYLTKDD
NGKFDTRELEDKFSEQLISNKQYSNQVDPELLDYSQDMDILQRYSEGLVTKAKLSLDWIE
AKYGPDSEIFNRISKGAYGFAQRGGENPDLVAEMFGYESGDALVRDLISAPTPKQRIEQL
TDERMAVQYSEFYDQQSIVEAVESALHNEIRARVLSAEMAALNGLLGRKSALNEAAKSVA
RDMIQRQKLKDIRPHLRAQDDARLGKMASDAFRKGQSVEAARHKRNQLVQFFATKYSYDA
KDQVQSHLNLVKKVFGNNEKLAKNRDFDMVTAARAILGKYDLGRESTNYEHQLDLIRKYD
PTTYAEIQNIGALPENQSYKELTLEQFSAVMAAVETLWHRSRENKVWHTTNEAIEREQVR
DELIQQSSGKKSVEKIQQDMLGKDKTAELKVKFMELGASAKRVDQVVTWLDGGVTGKYRE
YLINPMQDALSKYRIEKTKMLDDVVKIFEGFGKLDNSKIAAPELNNYTFVGKQALIHAIL
HTGNMSNKERLVIGYGWGSRLEDGSVDFSQWDQFFNRMIAEGTITKNDMDTAQKLWDLFD
RYKGQAQLTHKKINGRYFDELPTSPISTPFGEYKGGYVPASYDRIRSNEQDRIQDKNLAE
NNLQALDIATTGANFTKSRADRYSDMLELDLSRLPSHLDKELRYIHLELQIRQIGRLLLN
KDFRNELERVLPFATKQIFNPWLKAIADQSVDQSTDSRLLDNVFKALRRNTGIAIMAGNL
KNAIEQFTGFAQVAVAVPPKLLIKAQGEYFKSVVTRQHMAEQIMEMSDFMKTRWDQAADE
YRYAVDDMVFNKNAVQTVKDFTMKHAYVLQTTIQRPMEVVSWQAAFNHYTEMGLNQYDAV
HAADAVIRQYMTDMSPEGVSNLERGSPAKRMFLMFYNWFNMVWNTANTEVKLALEATNGS
WVKASPRLAYVALMMISIPSMLSELLGIIFAGGLEDSDDDGEKWDDLSAKLALSQFKMLS
AFVPYAGNVVNAAISNTDDNVMNDRYTASPVFSMGESGLGLIKHAKTALDEEKEVNQGKA
AKDFLNTATLTTGIPFAVLGKPSGYWLSISQGKKEAPESMYDAARGTITGKHAPEE

BLAST