GenomeNet

>tr:S2Y207_9ACTN [S2Y207] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EPD56335.1};
MSACAPTRTTDPTRAKHPHQPHSPPPAPNRRFRVAGADVSASIAVFLIALPLSLGIALAT
GAPLQAGLVAAAVGGFLAGWIGGCPLQVSGPAAGLTVVTADLIHQYGWRTTCAVTVLAGL
AQLGLGCLRVARSALAVSPAVVHGMLAGIGVTIAVAQVHIVLGGTPQSSVLANIRALPTQ
LANLHPAAVAVSVLTLTLLLLWPRITGRAGRMLRGIPDALVSVAGATVAASLAGLTLPRV
DLPSWRSHALAGLPQGPVLGLTAAVLTTTLVCSVQSLLGAVAVDKMVAARPGPPTHVERA
DLDRELLGQGAANVVSGALGGLPVAGVAVRSSANVKAGAVSRNSTMLHGVLVVVAALLMV
PVLEFIPLASLAALVMAVGIRMVSLHHIRTVTRHREVLVYAVTTLGVVIFGVLQGVALGI
AMAVAVAMQRLARTRITHEEKGGVHHVRVRGQLTFLAVPRLSRALHLVPQGAHAVVELDG
SFMDHAAYESLQDWQSTHTARGGSAELSGRRGGARTTKPALLTADTGAGDAVDAVAGVDG
SSVECRCSPWTPWRNHQCVRPRSAAPAGCSGTASGVEGVDGLGAEGGVLEGPGELRRVGG
LRRSGRLGGLGESSGVGGFRGSSELGGCSGPSGLDESSEPSELGGSSGPSELGGQSGVSH
LGGVSRSDGPGRLDRPGRLDRPGRLDASSRSGAPGHLDRPSRPDRPGHSDEANRPDRPGR
SGASSRPDGPGHLDGPSRPDRPGHLDASSRPDGPGRSGAPGHLDRPSRPDRPGHSDEANR
PDRPSRSGAPGRSGAPGHLDRPSHLDRPSRSDGPDRLDASSRLDVPERFDGPGHLDRPSG
PGGPSRSDRPDRPDGGPGQARYQLARGISAFQRNTAPLVRGELARLAREGQQPSQLFLTC
ADSRVVTSMITCSGPGDLFVVRNVGNLVPLPGAESGDDSVAAAIEYAVDVLKVRSITVCG
HSGCGAMQALLSAEPGAPTPLKRWLRHGLPSLERMAGGDRPWARPRLAGRGPADAVEQLC
LTNVVQQLAHLRAHESVSRALHNGALELHGMYFHVGEAQAYLLTGADDDEMFVHVTADSS
DTPGRRERHEHA

BLAST