GenomeNet

>tr:S4MK13_9ACTN [S4MK13] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EPJ35930.1};
MLEPESVRRGRAKPMSGVMKRMGMIFRAKANKALDRAEDPRETLDYSYQKQLELLQKVRR
GVADVATSRKRLELQLNQLQSQSTKLEDQGRKALALGREDLAREALSRRAALQQQVTDLE
TQHATLQGEEEKLTLAAQRLQAKVDAFRTKKETIKATYTAAQAQTRIGEAFSGISEEMGD
VGLAIQRAEDKTAQLQARAGAIDELLASGALDDQSGMHKDDIQAELDRLSGGTDVELELQ
RMKAELAGGSSSGQQALEGGTSQQQSQQQPQDTPRFDKQ

BLAST