GenomeNet

>tr:T0H2D0_9SPHN [T0H2D0] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MATDPFKYLDSMRAKSSQPVQGDDPFEAELRQQRDDELAYRIKVARPDEEARARALAEPR
GLAPSAVASNLPAFEAEARAAKAKNVMSQYPAIGRWSAKPGNAAIAADDYDNLSLFGKAF
YGLKNFGKTLEAGTWTALGGIYGAIGGLAENLDALSPSSDAERRAGVRSLPRLVADYALG
LQASDKTAAAKARPNVENWLARNLLQGVESLPTTAASVGVGVVAGPTAGASVMGASVAGN
EYAEARSKGLSVPRSAIYGASQGAVEFITEKLPVSRLVGDLAEKSPIGKTLMRQLAAEIP
GEQAATVLQDLNEWATLNPDKTIREFIAERPAAAAETLAATIGGVGTTVAVTKAAERTAR
IAGDMIDRRQQAERASLNAAFLEQVADATGKAKTMGRSPDAVADLVQQLGDDTGADRVFI
PAEALRAYEQSDGYSGEFDSYREAVDEAYATGGDLVLPVGELTRIAITPAWSALKDDMRL
SAGGMSFNEARTFDEAMADVMDQLSEQAAQEAEAARVAQEPRQKLQQSIADKLMNAGFTP
ATAIQQAELLTQREATRAARMGRDLTGQEFDPVEVRQILPAALAQIQAADNTDILIETMK
GGKEAKTALGPSLMDFISRGGGIEDTGGDLKAMGADAWHKGKPGKRKLVRSDSSNQASID
EGGLGINEYGADQWAQRAWEAGYFPEFGDTRPTANDLLDAIAEGVAGRDRHLVAQEKALR
DAAQELRAMLENRGIDPDAASRKEIKDAIAAYQQEAEGRAFDQGKDDAPRGRIVFPDGGN
AAAVIELFQSRDQSTFLHETGHLWLEQLRADAMEESASDQLKVDWRVVQDWFAANGHPLE
DGAIPVDAHELWARGVERYLMEGKAPTPVLRRAFEQFKSWLVSIYRSVDRLRAPITPEIR
GVMDRLIATDEEIEQARQEQGIEALFAEKPATMTEEEFGAYQASTEQARGEAHDALLARV
MNAVKRRVTKEYKDRREAIAADVAAQIDARPEFRALRQARETPLDSTWIREALGEDAPAM
LPKNVPPIFKDNGANPDEVAELSGFTSGDEMVRALMGVETARRQLREGGDQRSVRRALID
QETDALMMERYGDPFTDGSIEEEALAIIHNDQQGEVIAAEMRVLARSTGQRVTPYRIAKD
WAARSVRDGRVADVASRAVIQRYQRAAAKAGKAAMDAIIAGDNAEAFRQKQAQMLNNALV
SEAKRAADEIEAAVKRMSKVAAKRTMETVDQDYLERAQGLLEQVDLKQRSQRSIDRQESF
EAWAREQEEAGRDMIVPPSFAATLGTTNWSRLTVDQLLGLDAAVKQIMHLGRLKQKLLDA
KEERDYEAVVGEALAAAGGLPQKPSGVSFDEPGWFDKAKSFVLGLDAAMLKMETVFDWLD
QGPNGVFNRVVFQRFVDAQEQRRKRTADMMRRLEDARMKIPEAIRKRWGQKVTLTMIDPE
TGRPAVMTRDKLIAMALNMGNDGNARKLAGGYNWNEQSILDALNAELTPEEWQFVQDTWD
IVDTLWPDIAALERRVNGVDPEKVEARPLQTGAGELRGGYYPVVYDPTRSLDTERQNAVS
GDKLFESAYRRANTRAGSTNERTNVERPVMLSLSVISRHIGEVIHDITHREAVIDAHRFL
NDKRVIKAVRDTMGEHIQKQFNPWLQHIANEFAYDAQGMGSVEKLVKGLRTNATFVGMGY
RASTTLMQLAGVFNTAERIGSRWAAEGVYRFAKAPVETMRFVLESSQEVAARTETMDRDI
RDAIQREQSKLGFLSDVKRFGFYFIGMMDRFVSTAGWIGAYNKALNEGMADSDAIAFADK
TIRQSQGSGAAKDLAAIQRGKGAAGEAGKLLTMFYSYMSAFYQRQRTLARDYGTAFRTGD
VQDFPGLLARTVMLYFLPALAAELIAGRGPDDDEDWTQWVLETVGLAALGPIPLVRDVAG
GLASGFGYNFTPASGVGNSLVNAAKDIKRLVEGEETKRATRNVLETAGYLGAPVTGQMAA
SAQFLVDVGAGDQHPETFGDWWTGLTKGKIQE

BLAST