GenomeNet

>tr:U2FEQ1_9BURK [U2FEQ1] SubName: Full=YheO-like PAS domain protein {ECO:0000313|EMBL:ERJ35276.1};
MTTTRNKAPSEQASLIEQVQRIAEGLGAMFAPFTEVVVHDLRTPKHAILAIHNNLSGRAV
GDPATELGLARIADDDFPQVLANYPNRFADGRTAKSTSIGIKDSTGRYVAALCLNADTTL
FRGFQGMLNQFCSTDGEAVAETLDPAGADAIRQRIDAFAMRLATTPRELKTDQRRELMQA
LKADGFLEVRRAMEIVSQHLGVSRATVYNDAK

BLAST