GenomeNet

>tr:U2NY75_SERFO [U2NY75] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ERK16584.1};
MSDEQLASDAALQQFIDLSRLLTGFDRFELLGTGQAAFYFDWVQTHAAERFATLLATYGD
LPADAAQHSSFVETQLLGSEKLSTLVSSIIKLWYLGQWYSPDNPNETQIPSANSYQQGLV
WDAIHAHPQGAKQQGFGAWAEPPVTTSTVVKL

BLAST