GenomeNet

>tr:U2YVW3_9CAUL [U2YVW3] SubName: Full=Capsular polysaccharide export system periplasmic protein KpsD {ECO:0000313|EMBL:GAD59626.1};
MFGGEAPQASSAVVDPDYILQPGDTVQVTLWGMVEGSHELTIDAQGNVVVPGVGPIRLAG
VTAAQAPVVVERASRRIYNEGVQVYATPITTASTRVLVTGPVEQPGAFPGASDDASSSIC
SAQAASIRPAAAIDASGCCAGAR

BLAST