GenomeNet

>tr:U6GK46_EIMAC [U6GK46] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MGLFRSEPMRLGTLVLPQEGARDFIVAIGTAVKVQIEDMNGMSLSRGYRRQLQRLEELER
ILRYLKEKIEDISGVRLVHVAQDLDRAADAAAAAAAASVYNAAAAADHADVEAAGGGAAA
AASAAAAAAAAEKPQVYVLDRVEDMLNKVYRQFLRFAQNNQDLQREKIAAEEELAVVSFA
ASQLRSSLRSPWRLDPGSAAAAAAAAAAAAAEDPKIAATSTCSSSNTLQQQQQQQQTNTP
SAATADAHARSSSARRRRPTQLSSSNSGSSSSSSWQADVQQQEKQQTFPYSASRRLLSAG
GLGGLESGEMSSLVFSSVAGIVAAKDQERFARAMFRSTRGNAFTHFKRLEEEELTAYPHG
EEPKSLFVTYFQGAATGSAFMEKVKCVCSAMGARTYNWPHSGAEAQQRQQQLQQLLRDKA
AAAAAYEQYFLNEVGVFLEAVPASNLPLIPAAASAAAAAAAAEGDLTAAAAAAAAAAAGV
RRRPLITELQRFVERERAVYTTLNLFALSDATLQADCWFLEAEEAALRKTLAQVAAEKST
SAFLLVHASEGLGLRSPPTSFSRCSFMSSFQGLVDTYGVARYGEANPALFAAAIFPFLFG
LMFGDVGHGLLLLLLAAALLWCRSRGYVFTDELLCMLVEARYLILLMALHSIYAGFMYND
VFSMGINLFGSRWGPSKEGGPPEPVAGGPYPFGVDPAWKGASNELLFLNSLKMKLAIIVG
FVHMLLGLALFILNTIHFKDWRSLLLTAVLRLVLLLCLPVMFLGKPLLELYVHRRRQPPP
GFQSLNSVDSSAIQLQQLHQQQQQQQYHQPYHHHHQQQRQQQQQYVALATMGSRGEKDSR
AAAPSAAAAAVAAAGSGVAAAEEEMDVTELWLHNMIEGIEFVLGSISNTASYLRLWALSL
AHQQLSCIFFEKTVGLAFQPGLSPSQMAFKLIFFFPAFLCITIFVMVAMEALECFLHALR
LQWVEFQNKFYKGDGVPFRPLDLNCLPGDSTS

BLAST