GenomeNet

>tr:U6KYL5_EIMTE [U6KYL5] SubName: Full=Vacuolar proton-translocating ATPase subunit, putative {ECO:0000313|EMBL:CDJ43272.1};
MGIFRSERMRLGTLVLPQEGARDFITAIGTAVKVQIQDMNGHSLCRGYRRQLQRLEELER
MLRYLKEKIEEISGLSHDLDRAADAAAAAAAAAVHSSAAAADPRDVEAGGGPAAAAAAAA
AAAAAKPQVYVLDKVEDMLNKVYGQFLRFAQNNEDLKREKIAAEEELAVVSFAASQLRSS
LRSPWRLDPGSAAAAAAAAAAAAAEDVEIAATSACSSSNTLQQQQQQQQQTNTPRAVAAD
SHARSSSARRRRPTQLSSSSSSSSSLQTELQQQEQQQNFPYSASRRLLGTGGFPLENADI
SNLVFSSVAGIIFAKDQERFARAMFRSTRGNAFTHFKRLDEEELATHPNSSEPKSLFVTY
FQGAATGSAFMEKVKCVCSAMGARTYAWPHSGEEAQQRQLQLQQLLRDKAAAAAAYEQYF
LNEVGVFLESVPAVNLPLVPAAAAAAAAAAAAPGDRSAAAAAAAAAAAGLRRRPLITELQ
RFVFRERAVYTTLNLFAFSDATLQADCWFPESHEAAFRQTLAQVAAEKSTSAFLLVHGGC
VVSAPTYFRVCSFMSPFQNLVETYGVANYRELNAAVFAAAVFPFLFGIMFGDVGHGLLLL
ALAAALCCCSSSSSKVFTDELLRLLFDARHLLLLMALHSIFAGCMYNEVFSMGLNLFNSR
WYHLGAPPGGPPGSPLGGPPGGPHEGPLGAPQEGHPGGHLGGPVEGHLGAPLGGSPGGPP
GVPPGPLFQSREGPYPFGVDPAWRGASNELLFLNSLKMKFAVIVGFLHMCLGLFLAVLNC
VEFRDWRNLLLVVLPQFLFFVCLVGFLCFLIVLKWIAPSQLYNKPSLIAVLIDFLLAANP
SSSSELKLFDQQPQVERVLRLVMLLCLPVMFLGKPLFEVYVRRKKRPPPGFQSLNSLESS
SIQLQPLQQQPLQQQQQQQQVELGCAAAAQRELELPGSFSGTRARGRVGLGAAAAAAAPP
PPAAAAAAAAEDELAQLWLHTLVEAIEFVLGTVSNTASYLRLWALSLAHQQLALVFFDKT
VGAAFLPGQTVTQMAFKVRS

BLAST