GenomeNet

>tr:V2WA71_MONRO [V2WA71] SubName: Full=Glycoside hydrolase family 35 protein {ECO:0000313|EMBL:ESK83683.1};
MATMRSTLLFLIQFALLFTSLTLSAARGIASRQEGPRPRTWTDQVDYDEYSLIIKGQRVF
LHSGEFMTYRLPVPDLWPDILEKFKAAGFNGLSLYTHMGSINPSRGVVDFESYRALKPLF
EAAKEFGVWVVLRPGPYINAETSAGGLAHWTTTEVKGKLRSNASDYREAWTPYILGIIRE
AVDYQITQGGPIIAVQVDNEYGQDPGAGYFEDLKAVYRNESNGIVVPLTYNDPGMGRSFI
NGTGAVDLYGFDAYPNRYDCAHPNIWRPVPENYHEYHMEANRWQPLYIPEYQGGSLQAWG
PNTPDYSGCAALTGPDFESVFYKQLWADNVKLVNYYPLYGGTSWGSIPFHGVYTSYDWGA
AISEPRILTTKYTELKLQGTFLRSSPEFYKTDVVANSTEIPIIDTLNSSSLGFATLLRNP
DTGAGFWIVRHNDSTSTAISEFKLNVTTASGASLQIPNIARAITLDGRQSKALVTDYAFG
SSRALYSTAEVFFAGVIDGRDVLFLHGYSNQEHEVVLSLTGTNTANATSEFIIYTPEPAL
ADLAPNSTLVSFRKGIQGLHTLHASDTQLVVFADTSTAETFWAPSIASNTSEHASFWGIG
TNQSVLVGGPYLVRSAHIEGDTLALRGDLNASNVKKESRLMIIAPRSITKVTWNEGIVLL
DDSSVDDGYITGTIELAEKAEITVPELDGWKYHDSLPEIGDEFDDSQWVVANHTETNVPF
KMWYGDGRVLYGCDYGYCEGAVVWRGHFNAAGAEKSMNLSINGGQGFAATVWLNDLFLDT
SFGNSSNGANNINETDQVFTFPDGSVRLGQDNVVTVVQDNMGLNENWYTDDHMKSPRGIR
GFQLNSGNFSEWKVQGKIGGYTNFPDKVRGVMNEGGLFGERKGWHLPDFDTSSWENRSLS
DGLPNAAAGVGFFVTKFILSIPGGYDVPISFNFDEPFGQPYRALLFVNGWNMGKRIGNLG
PQAKFPVHEGILNYQGENTVAVALWSMTPNVTVSPTLSLAADGVFNGGVGRIRTNNPAWM
QEGRE

BLAST