GenomeNet

>sp:V4MA25_EUTSA [V4MA25] RecName: Full=OBG-type G domain-containing protein {ECO:0000259|PROSITE:PS51710};
MSTIMQKIKEIEDEMARTQKNKATAHHLGLLKAKLAKLRRDLLAPPTKGGGGAGEGFDVT
KSGDSRVGLVGFPSVGKSTLLNKLTGTFSEVASYEFTTLTCIPGVITYRGAKIQLLDLPG
IIEGAKDGKGRGRQVISTARTCNCILIVLDAIKPITHKRLIEKELEGFGIRLNKEPPNLT
FRKKDKGGINLTSTVTSTHLDLDTVKAICSEYRIHNADITLRYDATADDLIDVIEGSRIY
MPCIYAVNKIDQITLEELEILDKLPHYCPISAHLEWNLDGLLDKIWEYLDLTRIYTKPKA
MNPDYDDPVILSSKKRTVEDFCIRIHKDMLKQFKYALVWGSSAKHKPQRVGREHELEDED
VVQIVKKI

BLAST