GenomeNet

>tr:V4N6G3_EUTSA [V4N6G3] RecName: Full=Translation machinery-associated protein 22 {ECO:0000256|RuleBase:RU361273};
MAEKLEPAKVLYCGVCSLPAEYCEFGPDFERCKPWLVENAPDLYPDLLKEANEKAADNVS
DKLQSVGISSGGADGAPSSAHTGGTSKKEEVKRLPGGKVKKKERQEVIIEKVVRNKRKCI
TIVKGLELFGIKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDIIYDIVEFITDTWPD
VPERSIYFIEDGKKVQAA

BLAST