GenomeNet

>tr:V4U6L4_9ROSI [V4U6L4] RecName: Full=Homeobox domain-containing protein {ECO:0000259|PROSITE:PS50071};
MESGRLFFDRSSCPGNMLFLGNGDSFFGGARSMMSMEETSKRRPFFSSPDDLFDDCYYDE
QLPEKKRRLTAEQVHLLEKSFEAENKLEPERKGQLAKKLGLQPRQVAVWFQNRRARWKTK
QLERDYDLLKSSYDALLSSYDSLVKENQKLKSEVVSLNEKIEAKEEESKEAKSDKKTETH
HQPTEVTNNICGIQLQLSNNKTEDRLSSGCSGESAVVDEDGPQRVVDTGDSYFGCMDPVV
DAAQSEEDGGSDDGRSYFSDVLVVAPDHVSNQQHEEPLGWWVWS

BLAST