GenomeNet

>tr:V6KUH8_STRRC [V6KUH8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EST35076.1};
MSDATDFRALSELLTGEGRLNAQRADDYRVRLTAAFPADVPRLLDAYRTVTSQDDPGKAL
VDAVNADPALARLTRETITVWYTAQFTRPDGKPDAPGTPAQYQDGLIWRVIEAHPPSFAP
QPPAPSGYGYWTDHP

BLAST