GenomeNet

>tr:V7FHU5_9RHIZ [V7FHU5] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MDTIADYNAWKDKQQQNGVGAAQVVLGSVNEKPDEIAGDLNLANEFGKATGNPVPPLPMV
REYRNVFQQKIEEQKNKTILSSKPRLTEWLRSPDNAALARDDLQNLSWFEGFGRGVTNTL
SRSGDRLSQMGNQFMFEQTAGRDRDRSKLFGQILQEEKTSSGLKDMQGNPLETWTGAEYL
GAFGRWVDARYADMIGADDNAAAVQFAEGVKASQDRLAATPKSATAQSFEKAAIVKDATA
GQAIANFGTAFLQNPIGGLSWAMETAGESAPQLAAALVASRFNPALGVGVLGGGSYATER
YTAPADFLAEKGIDLGKPEDVQRVLSDPKLLEEAAKRGVIRGAIVGAFDLLSGGLAGKAA
SHNPIVEAIAQSAQQAILGSAGEYSARVASGQPIDWNDIVAEGVAEIATAPVDMGVAGRE
FAANRRKAKTAEGTVAQLGEISANAQASAVRARTPDKFRQFVEAATANGPVENVYVPAEQ
FSTYFQSLGVDPYALVDELDGVSRDDLDIALAGGGDLQIPTATYAAKIAGTEHDAFLMEN
MRFDPNEFTALEAKEFNERAQDAMDEAFQAAETARLEDEGSRSFEQQIYDTMVSRLREAG
RSTDVATTEATLYPAFYRTMAERSGQTVEDFMAAYPLPQVSGSIPEGMQFRDVDALNRTL
AEARARRSAGFDKRQSLLEFISDYGGINDVGGNLKARDAAVIKRKGKKSLKLARGGIVDG
VRDMFGQTSGKKHGIDDVAQAAIEAGYLVNDPVATDYRNAVKEGREVPNIGNALLDAIDR
ELRGEADYAVPADAAAADHSAQLDQIEAYLSSLGVGLDDDDAAIRAAVQADQADEGKKYG
QSGDVRGPRGSIQFPGGGVGNGDTVVRLFEGADLSTFLHESGHYFLTVLRDLAAKGEASS
SGDMESVKAWWGENADAVAKDGMRVMPDVTLTADDVNAALANGTTGDLMKDAAVDVGMQE
QWARGFEAYLMEGKAPSIELRGAFEKFRSWLISVYRRLAGLNVTVSDGIREVFDRMVASD
DEIAKAKEQAGDRGPIFATADEMGLTPGEFASFLKLRDQAEDDAKARLLREAMAPVKRAQ
EKWFKEERAKVREEVERQVNTYRYYRAWEWMGNRRWWDAETEPEGMPDIRLSKEILVQRY
GEGVLKTLPRGMQTIYAVEGGVDPDDAAGWFGFDSGDELVQALEKAPPRKEAIEAETDKL
MRERHGDVLTDGSVEAAALDALHSDKRGQWIAAELKAVVEVAGAGLGMTAKEARASARAS
IARMRVRDAVNSSRFLAAERKAADDAAKLGAMLSREKVWLDASRRRIETKARSASKGSTS
PDTVATAIDAYNAKFETTQSTFTVPDREAVSKSGNAFTIKGGERTATSLGYNDLVAKLVE
TKRRQLVNHALYMEARNVAGEVEKAENFVAKLGKKSTRERIAGAGRRENAQVDYLGAIDE
ILERYDFRKLSGAAEGRRGALNAFVAAMTAAGRENELAIPEAVLSDAARRPYKTLPVEEM
RGVVDSLKNLEHMATRWNKLIDAQKQRELEAVVTDVVAAFDANMPKRPPGRVGTKGEALR
HSVRQFFDLVLNAGTILREIDGFKDLGAAYRNIKTPIDEAMDRLTVRKLKAAGDLESLYA
VYDKADRRRMAVRDHIPELGYALSKWERIAVALNLGNAGNRARLTDPKVRGSLTEAQIAA
VIATLDAKDAAFVQSVWDYVGSFRDDIAARERRATGVEPEWVEATPVEIAGKTLKGGYYP
LKYDPRLSSLARDDEANNIAQALQAGRFGKAQTRQGHLKERVRSSGRDVELDMSVLHRHV
NQVIYDLELSEPVANSWRILQNGEIRSAFMEAGKQADFDALEIWLKDVAEGELKSADLVG
RAARTLKSNFTAAKLAFNISTVAMQVTGLSQSMVVVGKKDMAVGIMQAAKNPVSMARDIA
AKSPFMASRQTTFNKDIFDFYSDPKTGPVASRWGEIKAEIVGPMSFWLMTKVQWYLADVP
TWLAGYRQGLRQYGNDEAKAVAHADAVVKRAQASGLFADRSAVERGSVSRTARQNDVVRL
FTALGSYMFAKFNVAYERTAKAKRLIGQDGFSARSAQEALSWTLDMAFLFTLEAVVGAAI
RGRLPDDEDDKDDEWAAFLAKQTAFSVMGTLPFIRDSVSAMQGFEAGGAYGSFVKDVVRG
GKGVADILTAPFLEDGKVNASDLKAVINATCLATGLPAVQINRFVDAAWRQAEGKDVSPL
EYLLGRIGG

BLAST