GenomeNet

>tr:V8P2I1_OPHHA [V8P2I1] SubName: Full=Inositol 1,4,5-trisphosphate receptor type 3 {ECO:0000313|EMBL:ETE68485.1}; Flags: Fragment;
MNEMSSFLHIGDIVSLYAEGSVNGFISTLGSTTAVEICWMILGQSHSIQPISHDCYQILK
DLILKGRSSKLVDDRCVVEPAAGDLDNPPKKFR

BLAST