GenomeNet

>tr:W4Y7I6_STRPU [W4Y7I6] SubName: Full=Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_011692-tr};
MAALTTGATPYSDGLEVNFGGGPAREPPPPSPEYFILATIIANCVVLALDTHLPKEDKTP
RSIALEDTEIYFLAIFCLEAGIKIIALGFLLHEESYLRNGWNIMDFIVVVTGTVSVVEAS
NATQSGGFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIIRAMAPLLQITLLILFVIIIFA
ITGMEFFMGKFHQTCYVFDPISGNETREIAEDNPQVCGYRQCGDFENCTGYWDGPNFGIT
NFDNMLYAMLTVFQCITMEGWTDIMYNCNDSEGPQFVWVYFIPLIILGSFFMLNLVLGVL
SGEFAKERERVENRRAFLKLRRQQQIDKELMGYLEWICKAEEVMLNDKSISEEEREAIED
RRRDAATRTEDLGNGKPSGADVASSYDLDTDKDPNSNSPTKEKKKKKRKKKFVRIRRAEK
RLRFAIRHAVKTQAFYWLVIVLVFLNTICVAIEHYNQPHWLEQFLYYAEIVFLCIFIMEM
VIKLYGLGPGVYFQSAFNKFDCIVICASMFEVIWTKYKEESFGLSVLRALRLLRIFKVTR
YWTNLRYLLISLVHSIQSIVSLVFLLFLFLVIFALLGMEFFGGEYWSSLRNLVISLLSSM
RSIVSLLFLLFLFILIFALLGMQLFGGSFNYDATQAKPSSNFDTFWIALITVFQILTGED
WNVVMYQGIKSQGGVPNGMWASIYFVILVLFGNYTLLNVFLAIAVDNLANAQELTKLDQE
EDEENRQAAANELLELQAQQTPNMSRRGSPNPDNPSIKKANNNKEQEAEDENDESFHPKP
MVPYSALFIFSTTNPVRRFCHYIVTLRYFDTMIMVVIALSSIALAAEDPIDPDNKRNKVL
EYFDYIFTGIFTIEMVLKIMDMGLLLHKGAYMRDLWNILDAIVVVCALFAYAYRGGGTSG
GPQQLNTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSVKNVTNIAIVYLLFMFIFAVI
GVQLFKGKFFHCSDLSKVTEEECQGRYFLYEGDQIKESADRVWDKYEFNYDNVALAILTL
FTVSTGEGWPDVLKHSIEATEEGMGPTPYNRIEMSLYYVVYFIIFPFFFLNIFVALIIIT
FQEQGDQDFFDGEIDKNQKQCIEFCITAKPVDRFMPENKNSFRFKVWKLVVSSAFEYFIM
TLITLNTFTLMVKYHGQPEIYSAILKNLNIAFTVLFTIEAMLKLTAFGIRNYFKEGWNTF
DFITVVGSVADVIISEVGDGFINLSVLRLFRAARLIKLLRQGSSIRILLWTFIQSFKALP
WVCLLIWMLFFIYAIIGMQIFGNIAPIDGQQINRHNNFGQFFSSLLLLFRCATGEAWQSI
MMSCLPGAACADPDPNNLSGIKEFDTCGSYFSYVYFVSFSFLCSFLMLNLFVAVIMDNFD
YLTRDASILGAHHLDEYVRIWGDFDPVGSGRVLYKDMYDMLKNIEPPVGFGRNCPYRIAY
KRLIRMNMPVDENKMVQFTSTLMALIRTALDIKIGSVADRDRHDAELREAVKCFWPHLSG
DKLDLLVPPDSELIGEKLTVGKIYAALLIYETWREYKAKIQRDGHARTELVYFKYLYKKY
PGFDINDERYQNTFSDEFRRRPSLFRRLVGAVKKNSNENLPGLAEEGGSTSGTVAIKEEK
TPSPPPKEKERPRPGKVVTTLPRIDSSGSEGLMVDQPLKQASPKQAERYQRKGRDPDRES
RHHRYREPPDNSRTLPLDPSEDCVAPVSGNTDLGLLDLGLDLTGVAQSDQDEFLMSQSTN
MTSIYGEYDNHSYEYDEEEEEEVDLGVEGTSALEEQEFEDDKAIEMSDIRYRDRDERGKG
GPVDRRERHSMDKHAIQYSNNTTGGNTPYSHSDYSLARGGTGRERERDRERSSERARPRV
RHSVAISSDEVPFSDRERFSEERRHYPERDRENASREKRHSLPPVNNFDQMERPRGRPPQ
SMSQGGLSGRSGSSDGHGSTGNKAIDAILKKGSDIRAQNRQDPTGHGQTPRDGQPRDGQP
RDGQPTDRERKMGIPRQRPRQGSLPAPPITGSHSMPAFDDGRPTRQRHSVGSPSMPDFQG
RGTPRQPGGGFTSTPAGDDRRDQRRPSGEPSSRKRSNRHDDALIDTRPPQQDIIPEEDEG
VPPDGSDVLRRTARNNRKNSGGHLGQYQKFDNSLDSEEPPSQAPGQDVRGERDTVEGSYY
NEDAVSSNNRASNYARPTEGASSSSRHERLDSEDSVSSSQPLLSPGRSPSPRRRAPISTR
DVSPQRFPPSHSPSSRRRDRHRGPDYVEFHDRDMYDEPSYDDPFGPERSGGSSHRRPSPG
WREPRDLLQAGPSQSRASSSERMDPESSQSSPPSRKHTGRRLPTVPGETRGGGGGGGGGS
VTPRQRQRPTVPRSRDHSPMRLPPPQHGGRNSGGGSKGDVRLQMDERPPHYDVVMRTQDA
PSPDQHVDPRMPNGFRPGGVEKGRGHGTQGHSPRRTPQGVPRGPGRKHVTDNGQGGNGGY
SDTEEDEWA

BLAST