GenomeNet

>sp:W5L029_ASTMX [W5L029] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSAMXP00000013191};
MVHLVRPRGHSRKEICGAENEERYTGKLPVGVCTHTHTHTHTHIHTRAPRPAQSLSLALS
LSLSLSYSIPPHEDRWRVTRRLKVKRERHNEDDVEDDDDDDDEVETHVLSVCMSACVCLC
GGRRNQCNLSGRNNGPASAPFCCPLQGQIPPLVRAEITALESEPHADRRLKTARFLSMKQ
EDAMAEGPRCKRRKQANPRRKNVLNYESVVEAGSGSEDEDRLLGSEGEGSPLGVPSLEAS
PRVAHALLSCRGDEEAESRDLWRHGDLNGTEERKDEYNPLSPDVSLHGAGNGTVKGIDAT
SELESFFAKRKLEDSEGHPASIAEYLQRGDTAIIYPEDPEEGTRLGTPEANGQDDNDNDL
ALRTPDDFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEESFPCPLCSDTFAYRTQLERH
MATHKPARDQPQLLNEGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF
SHSGSYSSHISSKKCIGLISINGRVRHGVSSKAGSSPNSAASSPGSPALAQLRHKLENGR
SLGLQDPSIHPDVKAEPMDFNEYRLLLASQPEFGGSGAFLNGTGRGGSPLGMHNSSQNSL
QHLGMGLDAHQLGYQGLTNNLSEVHRVLQIVDNTVCRQKMDGNPEEISKLRAYMKELGSQ
MEEQKLALASQPGFHGIGHNSPTKSIIDYTLEKVNEAKACLQSLNEDSKRRIVDIKKERP
SHIMDLEPEEKTQERDGQYVPFSCQYCKETFPGPIPLHQHERYLCKMNEEIKAVLKPNET
LPASRRGMFGTEQQAVMVSSSVPDRNATSPVNPFKDHMLVLKDCFAMNNDPNSEELRKIT
MAVGLSQEFVKELFAQWRAQSLHGMSRKRSPPPERNSGNINHSFVRESALARSPASIGQY
SDSTAELHGATNGDAGHHLSKHHQFTGIRQTNEKPLDSVDHLRGETPSPLNLSSTSSKHS
HSSSYTPNSLASEDAHGEPLDLSLPKHFSKAEKRSKPNGFNIDRNGDPAVREQGTEPLDL
AHIKKEFNGSNSMGNESQMDKSSSPIFGINPFSGGPMYTSLPTHGAFPPPTFMSPAQASI
PGLRPYPGLDPMSFLPHMAYTYAAGAATFAEMQQRRKYQRKPSFQGDLLDSTGDYLSGLE
DLTDSESLLARKKIKKTESGMYACDLCDKTFQKTSSLLRHKYEHTGKRPHQCQICKKAFK
HKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREAAKQEGHD
AGTGPLEPTELLMRRAYLKGLGPLGFSDPEDQSEDVTRAGNVILRDGTEGVSREVEKTYQ
EVTDRQGLGFRVDEEMEEAALEEEEEERKRLEGGRSPDGTVKGEKENGALGGMEDESLEE
RKPAAEQGKTLDREGENEDAD

BLAST