GenomeNet

>tr:W5M3L8_LEPOC [W5M3L8] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSLOCP00000002976};
MTAAVDMKPTLTIIKTEKMEDLECSDVPLLTPGSKEMMSQALKATFSGFTKEQQRLGIPK
DPRQWTETHVIEWLTWTVNEFSLKNVDFHKFCMNGASLCALGKERFLDLAPDFVGDILWE
HLEMLQKDVKHFPVNGLTSNIQESRYTSDYFVSYGIEHAQCVPPSEYSEPGFITESYQTL
HPISSEDLLSLKYESDYPSVILRDAPLNPLQGDYFSIKQEVISPDNMCVGRISRGKLGGQ
DSFESIESFESCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPSALHGHKPKGTFKDYVR
ERADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPD
EVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYTPEEL
HAMLDVKPDADE

BLAST