GenomeNet

>tr:W6TGG1_9SPIR [W6TGG1] SubName: Full=Putative cytosolic protein {ECO:0000313|EMBL:ETZ17458.1};
MTSQESPEQDTVVRHDDTIEIRNLNRRTSTDPSDLLVLDDGFSSCHAITFDDFRKELHKK
TFVKGEGVNDFKEVIQSLIATELLQNTNFINQAYQKVIEKLKNNESSVMDSILSKVTSKL
EYDLSQQDTLNTNTYFLGLHYSSLKKIKVQEYLTGISSSFSTSTTTIKPESQYSGEYNKT
VYMSSLKYGRYVFDFTDSSQENQNSEIIIETESSYDDKPIYLNVQVRAISSSVSRARKTV
NIKYNSNSSKRTVFRLGSINGGTGLRLNLFEGWYMQKRVDGMPLLLKL

BLAST