GenomeNet

>tr:W8IE33_ENSAD [W8IE33] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AHK46860.1};
MTDHVARGGLSTAEIEREDAARHSAAAERGDAPLLPSERLWGFWEFTYANSALAIATWAF
LIGGAIGLFVGPKEGIAAIVIGNIVGVVLTSLATTCMSGRYGVEQFIALRSQFGYNGSRV
VYVLAVVLLTMGWLAVLAMMFGRSIDGLMALSAGEAANPTGVKMVIAAIGAILVTWFIVA
KGPTSIKFFNMVVSPALVILMGVMLYLILSQRSFSELLALPALDPPFEDNTLNFIVAVEV
NLAAGFSWWPYIGNLARLTKNERTAFWPNILGIFGAAALGEIVGLLAAVSLGESDPTIWM
TKIAGPVIGIIALLFVAFANMTSMANILYTSIVGLRQVGTASVRRIPWGTVLFLFCLIPL
GLVVFYPQMYDGFFIFLVWTSALNSALAGIGIVDYFFLRGQKLDMRSLHGPQQNGPYRFW
AGFNPIGLLALAVGCIVYVVIFNPQTLASLPAFKYLTASIPACVAAGAVHYVLTRLFARG
RGWGQYP

BLAST