GenomeNet

>tr:X8CKM3_MYCIT [X8CKM3] SubName: Full=DNA polymerase LigD, polymerase family protein {ECO:0000313|EMBL:EUA56932.1};
MAAAEEIDVDGVAVRLTNPDKVYFPKLGSKGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
EMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDRRNGKK

BLAST