KEGG   Homo sapiens (human): 387733Help
Entry
387733            CDS       T01001                                 

Gene name
IFITM5, BRIL, DSPA1, Hrmp1, OI5, fragilis4
Definition
(RefSeq) interferon induced transmembrane protein 5
  KO
K06566  interferon induced transmembrane protein
Organism
hsa  Homo sapiens (human)
Disease
H00506  Osteogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    387733 (IFITM5)
   04147 Exosome [BR:hsa04147]
    387733 (IFITM5)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   387733 (IFITM5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   387733 (IFITM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD225 DUF3708 DUF4338
Motif
Other DBs
NCBI-GeneID: 387733
NCBI-ProteinID: NP_001020466
OMIM: 614757
HGNC: 16644
Ensembl: ENSG00000206013
Vega: OTTHUMG00000165355
Pharos: A6NNB3(Tbio)
UniProt: A6NNB3
Position
11p15.5
AA seq 132 aa AA seqDB search
MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS
IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA
FFSTKFDDADYD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggacacggcgtatccccgcgaggacacccgggcccccacgcccagcaaggccggtgcc
cacacagccctcacactgggggccccgcaccccccgcctcgagaccacttgatctggtcg
gtgttcagcaccctctacctgaatctgtgttgcctcggcttcctggcgctggcctactcc
atcaaggcccgagatcagaaggtggttggtgacctggaagcggcccggcgttttggctcc
aaagccaagtgctacaacatcctggccgcgatgtggacgctggtgccgccactgctgctc
ctggggctggtggtgactggtgccctgcacctggcccggctggccaaggactctgccgcc
ttcttcagcaccaagtttgatgacgcggactatgactga

DBGET integrated database retrieval system