KEGG   T30169 (Metagenome): 24219
Entry
24219             CDS       T30169                                 

Gene name
flu
Definition
antigen 43 (ag43) phase-variable biofilm formation autotransporter;
CP4-44 prophage
Best hit
eco:b2000 (best score: 118.627)
Taxonomy
Gammaproteobacteria - Enterobacteria [GN:eco]
Other DBs
HMP: SRS013158.24219-T1-C
Position
SRS013158_Baylor_scaffold_9324:complement(156..359)
AA seq 67 aa
GLSLDDGKDNAGYVKFGHGSAQHVRAGFRLGSHNDMTFGEGTSSRAPLRDSAKHSVXXXY
PHLQLPG

DBGET integrated database retrieval system