KEGG   Acidovorax avenae: Acav_0555Help
Entry
Acav_0555         CDS       T01445                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aaa  Acidovorax avenae
Pathway
aaa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
aaa01230  Biosynthesis of amino acids
Module
aaa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acav_0555
Enzymes [BR:aaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Acav_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADX44478
UniProt: F0Q650
Position
598317..599117
Genome map
AA seq 266 aa AA seqDB search
MSDILNKIVAVKREEIAAAQKKTPLAAMRADAESRVLTRDFEGALRAKIAAGQAAVIAEI
KKASPSKGVIRENFVPADIAQSYAEGNGKVSAACLSVLTDRQFFQGQPDYLKQARASCAL
PVLRKDFMVDAYQIYESRAMGADAILLIAACLEDAQMAEFEAIAHSLGMAALVEVHDGAE
LDRALKLRTPLVGINNRNLRTFEVSLDTTVSLRKAVPSDRLLVAESGILTPQDVKTLRDA
DVHAFLVGEAFMRAQEPGAALAKLFS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatcctgaacaagatcgtggccgtcaagcgcgaagagatcgcggcggcccag
aagaaaacgccgctggccgccatgcgcgccgatgccgagagccgcgtgctcacgcgcgat
ttcgagggcgccctgcgcgccaagatcgccgctggccaggcggccgtgatcgccgagatc
aagaaggccagccccagcaagggcgtgatccgcgagaacttcgtcccggccgacatcgcc
cagagctatgcggagggcaacggcaaggtcagtgcggcctgcctctcggtgctgaccgac
cggcagttcttccagggccagcccgactacctcaagcaggcgcgcgcgagctgcgcgctg
ccggtgctgcgcaaggacttcatggtcgatgcctaccagatctacgaatcgcgcgcgatg
ggtgccgacgccatcctgctgatcgccgcctgcctggaagacgcgcagatggcggagttc
gaagccatcgcgcacagcctgggcatggccgcgctggtggaagtgcacgacggcgccgaa
ctggaccgggccctcaagctgcgcacgcccctggtgggcatcaacaaccgcaacctgcgc
accttcgaggtgtcgctggacaccaccgtctcgctgcgcaaggcggtgccgtccgaccgg
ctgctggtggcggaatcgggcatcctcacgccgcaggacgtcaagaccctgcgcgatgcc
gacgtgcatgccttcctcgtgggcgaggccttcatgcgggcacaggagccaggggccgcg
ctggcgaagctgttctcctga

DBGET integrated database retrieval system