KEGG   Acidovorax avenae: Acav_1056Help
Entry
Acav_1056         CDS       T01445                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aaa  Acidovorax avenae
Pathway
aaa00051  Fructose and mannose metabolism
aaa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Acav_1056
Enzymes [BR:aaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Acav_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADX44978
UniProt: F0QBB6
Position
complement(1180567..1181307)
Genome map
AA seq 246 aa AA seqDB search
MKHFAQKQHVVDLCLTLSRLGYFAGTGGNIMLRLDAGHVAVTPSAVDYHAMRPADVCVLR
LSDLQQVDGDRAPSVEAGLHAGLLRARPDAGCSIHTHQPVASALALLGRAVPVPPRWQAT
LGPFLPMVGYAPSGTGWLAAKFARAVQPGTQAYLMRNHGILCCGRDSQAALQAVDDLEAL
ARALLADRIAERAATATALADTAGSDALWRVHDALQERNGSPPPHPPHATHQPLQPAPSR
EGLPAY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacttcgcccagaaacagcacgtcgtggacctctgcctcaccctgtcgcgcctc
ggctattttgccggcacgggcggcaacatcatgctgcgcctcgatgccgggcacgtggcc
gtcacgccctcggccgtcgactaccacgcgatgcggcccgccgacgtctgcgtgctgcgc
ctgtcggacctgcagcaggtcgacggcgaccgcgccccatccgtggaggccggcctgcac
gccggcctgctgcgcgcgcggcccgatgccggctgcagcatccacacgcaccagcccgtc
gccagcgccctggccctgctgggccgcgccgtgcccgtgccgccgcgctggcaggccacg
ctgggccccttcctgcccatggtgggctacgccccttccggcaccggctggctcgcggcc
aaattcgcgcgggcggtgcagcccggcacacaggcctacctgatgcgcaaccacggcatc
ctgtgctgcggccgggacagccaggccgccctgcaggcggtggacgacctggaagccctg
gcccgcgcgctgctggccgaccggatcgccgagcgcgccgccacggccaccgccctcgcc
gacaccgccggcagcgatgcgctgtggcgcgtccacgatgcgctccaggagcgcaacggg
tcccccccgccccatccgccccacgcaacccaccagcccctgcagcccgccccatcccgg
gaaggcctgccggcgtactga

DBGET integrated database retrieval system