KEGG   Acidovorax avenae: Acav_1280Help
Entry
Acav_1280         CDS       T01445                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aaa  Acidovorax avenae
Pathway
aaa00010  Glycolysis / Gluconeogenesis
aaa00051  Fructose and mannose metabolism
aaa00562  Inositol phosphate metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
aaa01230  Biosynthesis of amino acids
Module
aaa_M00002  Glycolysis, core module involving three-carbon compounds
aaa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_1280
   00051 Fructose and mannose metabolism
    Acav_1280
   00562 Inositol phosphate metabolism
    Acav_1280
Enzymes [BR:aaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acav_1280
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acav_1280
  Exosomal proteins of bladder cancer cells
   Acav_1280
  Exosomal proteins of melanoma cells
   Acav_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADX45202
UniProt: F0Q0H7
Position
1423528..1424283
Genome map
AA seq 251 aa AA seqDB search
MTKKKLIAGNWKMNGALGANAALLQALRGGLEAGAFQNVDVAVAVPAAYLAQVQGLAEGS
AIALAAQDVSRHEVGAYTGEISAAMLQEFGVRYVLVGHSERRQYHGETDEQVAEKAQRAL
AAGITPVVCVGETLAEREAAQTEAVVKRQLAAVIHLNGHCISETVVAYEPVWAIGTGRTA
TPEQAQQVHAVLRAQLAAASEHADRIRLLYGGSMNAANAATLLAQPDIDGGLVGGASLKA
QDFLQIIAAAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaagaaactcatcgcgggcaactggaagatgaatggcgccctgggcgccaat
gccgcgttgctgcaggcgctgcgtggcggcctcgaggcgggcgcgttccagaacgtggat
gtggccgtggcagtgccggcggcctacctcgcacaggtgcagggcctggccgaaggctcg
gccatcgcgctggcggcgcaggatgtgtcgcggcacgaagtgggtgcctacacgggtgaa
atctccgcggcgatgctgcaggaattcggcgtgcgctacgtgctggtcgggcattccgag
cgccgccagtaccacggcgagaccgacgagcaggtggccgagaaggcgcagcgcgcgctg
gccgccggcatcacgccggtcgtgtgcgtgggcgagacgctggccgagcgcgaggccgcg
cagaccgaggccgtggtcaagcgccagctggccgcggtcatccacctgaacggccattgc
atcagcgagaccgtggtggcgtacgagcccgtctgggccatcggcaccggccgcaccgcc
acgcccgagcaggcgcagcaggtgcatgccgtgctgcgcgcgcagctggcagcggccagc
gagcacgcggaccgcatccgcctgctctacggcggcagcatgaacgccgcgaatgcggcc
acgctgctggcccagcccgacatcgacgggggcctcgtgggcggcgcatcgctcaaggcc
caggactttttgcagatcatcgcagcggcagcctga

DBGET integrated database retrieval system