KEGG   Acidovorax avenae: Acav_1507
Entry
Acav_1507         CDS       T01445                                 

Definition
(GenBank) FHA domain containing protein
  KO
K07169  FHA domain-containing protein
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Acav_1507
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ADX45429
UniProt: F0Q327
Position
1677461..1679818
AA seq 785 aa
MDKVELRVIRHADEAVDRLWTAVFGVAGGTIGRGGQNKLVLSDGDAGVARVHAMVRIESE
AAFIANLCERRSIFVAGAEVRSGEEVRLSVGDEVRIGPYVLHSVVPGSPFVPVAAAPAPA
AVPAPAPVSAPSPVAIPSPPVAAASEPVSVAAPVANVPQGEGLPVAPSQPVAMPVTGMGD
GLAAVASSAEDDDNPFAMLGRVEGPAIAAVAPSQAPVASPTASSVPAPASAPAFSSVPTA
TPAPPAGSAPVPVPDEAHGFATSPAPVPAGPGGQGNAWPPAVPQDRPAAAPRALVIPEDF
DLFAADPRKSEEKKDAWGSGLQAKSLSEIANMRHDELLQSLPASGAKFAHDMDNPAHAGL
PKALDPRDELDPLRLFTGDSDATPALVPERSAMALGSGSDLSQSFSLPRGVQAPVGQGLP
GAAPAPGGPVPIAQGAGTGPGMASAAPSAPPLDGLQRVEGLDLGAFGSGATSADPLGWPP
VESGPVAAPAPAPVAADALLQAMPSGLAAGDARAVAIEEVPLAHVPAAAGAVPAPVPAPA
PTMAPAPIQATAPAPAAPHGPAREEGSAKSPLVPVLPELEAASPAELQSLIAAFLDGAGV
LQKKVEPQKLSPEFMRSFGEAFRVAVQGTIDLLAARSEIKREFRAGVTVISSGANNPLKF
LPTPEGVVMQMIGQNFPGFMKPIPAMQEAYDDLRVHQVALMAGLRAAYAEALERFDPAAL
EQRTDVTGGVFGKLSATSRKAALWDEYKRNFAEIRRGAEDDLAAFSGQAFLEAYENAEAA
AKART
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggataaagtcgaactcagggtcatccgccatgcggacgaagcggtggaccgcctatgg
acggcggtattcggcgtggcgggaggaacgattggccgcggggggcagaacaagctcgtg
ctgtccgacggcgatgccggcgtcgcccgcgtgcatgcaatggtgcgcatcgagtcggag
gccgccttcatcgccaatctctgcgagcgccgctcgattttcgtggcgggtgccgaagtg
cgctcgggcgaagaggtgcgcctgtccgtgggggacgaggttcgcatcggcccctatgtc
ctgcattccgtcgtgccgggctcgcccttcgttcccgtggcggctgctcctgctcctgct
gcagtccccgctcccgcacctgtatctgcaccctctccggtagcgattccgtcgcctccg
gttgccgccgccagcgagcccgtgtccgtggctgctccggtggcgaacgtgccacagggc
gaagggcttcctgtcgcgccgtcgcagcctgtggcgatgcccgtgaccggcatgggcgac
ggcctggcggcggttgcgtcctccgccgaggacgacgacaacccatttgcgatgctcggt
cgcgtggaggggccggccatcgcagccgtggccccgtcccaggcgccggtcgcctcgccc
acggcttcgtccgtacctgcacctgcatcggcccctgcgttcagctccgttcccaccgcc
acacccgcgccgccagccgggtccgcgcctgttccagtcccggacgaggcccatggcttc
gccacgtctcccgccccggtgcctgccggtcctggtgggcagggcaatgcctggccaccg
gcggtgccgcaggacaggcccgccgcggcaccccgggccctggtcattccggaagacttc
gatcttttcgcggcggacccccgcaagagcgaagaaaagaaggacgcctgggggagcggc
ttgcaggcgaagagcctgagcgagatcgccaacatgcggcacgacgagctcctgcagtcg
ctgccggccagcggcgcgaaattcgcgcacgacatggacaatccggcccatgccggcctg
cccaaggcactggacccgcgcgacgaactcgatccgctgcgtctcttcacgggcgactcg
gatgcaacgccggcactcgtgcccgaacggtcggcgatggcgctcggttcggggtccgac
ctgtcgcagtctttcagccttccccggggcgtgcaggcaccggtgggccaggggctgccc
ggcgcagcaccggcgccgggaggccccgtgccgatcgcccagggggcgggtaccggcccg
ggcatggcttccgccgcgccgtcggcccctccgctggatgggttgcagcgcgtggagggc
cttgacctgggggccttcggctccggggccacttcggccgatccactgggctggccgccg
gtggaaagcgggcccgtagccgcacccgcgcccgcgcccgtggctgccgatgcgctgctg
caggccatgccttcggggctggctgccggcgatgcgagggcggtagccatcgaggaggtg
ccgctggcgcatgttcctgccgcggcaggtgccgtgccggctcccgtccctgcgcctgct
ccgaccatggcgcccgctccaatccaggcaactgctcctgcccccgccgcgccccatggc
ccggcaagggaggagggctccgcgaagtcgcccctggttccggtgctgccggaactggaa
gccgcttcgcctgcggagctgcagtcgctgatcgccgccttcctggatggcgcgggagtg
ctgcagaagaaggtcgagccgcagaagctcagccccgagttcatgcggtccttcggggag
gccttccgcgtggccgtgcagggcaccatcgacctgctggcagcccgctccgagatcaag
cgcgaattccgtgcgggcgtgacggtgatttcctccggcgcgaacaatccgctgaagttc
cttccgacgcccgagggcgtggtcatgcagatgatcgggcagaacttcccgggattcatg
aagcccattcccgccatgcaggaggcctacgacgacctgcgtgtccaccaggtggccctg
atggccgggctgcgtgcggcctatgccgaggcgctggagcgcttcgatcctgcggccctg
gagcagcgcaccgacgtgaccggaggggtgttcggcaagctgtcggccacgagccgcaag
gcggcgctgtgggacgagtacaagcgcaatttcgccgagatccggcgcggcgccgaggac
gacctggcggccttctccggccaggccttcctggaggcctatgaaaacgccgaggcggca
gcgaaggccaggacgtga

DBGET integrated database retrieval system