KEGG   Acidovorax avenae: Acav_1509
Entry
Acav_1509         CDS       T01445                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
aaa  Acidovorax avenae
Pathway
aaa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Acav_1509
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aaa02044]
    Acav_1509
Secretion system [BR:aaa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acav_1509
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ADX45431
UniProt: F0Q329
Position
1680647..1681228
AA seq 193 aa
MHRETMARKGFIRAGLAAAVAAWLLGGCGMISNLNRPQEAPTAVPPAVFEIVADPGVNPD
IHGTPKPILLRIYELRAAAAFDRASYLDLQDKDEAQLGADFVRREEILLQPGERRTIERK
GSADVRTFAVFAGYRDLERSTWRATAGAPNSVEMRRRWWGLGETERLKPVQYSITVGKDA
VKIQTAPAPAPAR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcatcgggaaacgatggcacggaagggattcatcagggcggggctcgcggctgcggtg
gcggcatggctgctgggcggctgcggcatgatcagcaacctgaaccgcccccaggaggcg
cccacggcggtgccgccggccgtcttcgagatcgtcgcggaccctggcgtcaaccccgat
atccacggcacgcccaagcccatcctgctgaggatctacgaactgcgcgcggcggcggcc
ttcgaccgggccagctacctggacctgcaggacaaggacgaggcccagctgggggccgat
ttcgtgcggcgcgaggaaatcctgctgcagccgggcgagcggcgcacgatcgagcgcaag
ggcagtgcggatgtccgtaccttcgcggtgttcgcaggctaccgcgacctggagcgcagc
acctggcgcgcgaccgcgggcgctcccaattccgtggagatgcgccgccgctggtggggc
ctgggcgagaccgagcggctcaagcccgtgcagtacagcatcacggtgggcaaggacgcg
gtgaagatccagaccgcccctgctcccgcccccgctcgttga

DBGET integrated database retrieval system