KEGG   Acidovorax avenae: Acav_1514
Entry
Acav_1514         CDS       T01445                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aaa02044]
    Acav_1514
Secretion system [BR:aaa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acav_1514
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ADX45436
UniProt: F0Q334
Position
1688354..1689403
AA seq 349 aa
MIDIEELLEPAADTPPCGQDLTYDAEFLALETAATGKPEQQFGETVIPAEPPDWRDVERR
ARALLVRTKDARVAALLCRALTNIQGVRGMSQGVQLMAGMFARYWDDLHPLPEDGDYFMR
MNAVSSLNEITGLLRDLRQQDFVRLPGGSISVRDAEAVARGTAAEGGARISLDQLRVALA
QAWQQGDESLRAWSTASEALRSLQTTFRDRLESSQVPDLEQFQSLLVVLNDLVPHAPIGV
ADVATGAPEEGAAPGAIAVAAGAGAAGAVGEPAGVAGRPAGLRTRDDALAQLLLVAEFLE
RTEPTNPAPLLIRRAAKLMGLSFLDILRELSPDSVGQVETITGGQNPSS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgatcgacatcgaagagcttcttgaacccgcggcagacacgccgccctgcggccaggac
ctgacctacgacgcggagttcctggccctggagaccgcggccaccggcaagccggagcag
cagttcggggaaacggtgattcccgccgagccaccggactggcgggacgtggagcggcgc
gcccgcgcgctgctcgtgcgcacgaaggacgcgcgcgtcgcggccctgctgtgccgggcg
ctgaccaacatccagggcgtgcgcggcatgtcccagggcgtgcagctgatggccgggatg
ttcgcccggtactgggacgacctgcacccgctgcccgaggacggcgactatttcatgcgc
atgaacgccgtgtcctcgctgaacgagatcacgggcctgttgcgggacctgcgccagcag
gatttcgtgcggctgcccggcggctcgatcagcgtacgcgatgcggaagcggtggcgcgc
ggcaccgccgccgaaggcggcgcgcgcatatcgctggatcaactccgggtggcgctggcg
caggcgtggcagcagggcgacgagtccctgcgcgcctggagcacggccagcgaagcgctg
cgcagcctgcagacgacgttccgcgaccggctggaaagctcgcaggttccggacctggag
cagttccagtcgctgctggtggtcctgaacgacctggtgccgcatgcgcccatcggggtg
gccgatgtcgccacgggtgcgccggaggagggcgctgctcctggagccatcgcggtcgcg
gcgggggcaggtgcggccggtgcggttggcgagcccgccggggtggccggcaggccggca
gggctgcggacccgcgacgacgcgttggcgcagctgttgctggtggccgagttcctggag
cgcacggagcccaccaaccccgcgccgctgctgatccgccgggcggcgaagctgatgggc
ctgagcttcctcgacatcctgcgcgaattgtcccctgacagcgtgggccaggtcgagacg
atcacgggagggcaaaacccgtcgtcctga

DBGET integrated database retrieval system