KEGG   Acidovorax avenae: Acav_1515
Entry
Acav_1515         CDS       T01445                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aaa02044]
    Acav_1515
Secretion system [BR:aaa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acav_1515
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADX45437
UniProt: F0Q335
Position
1689564..1690112
AA seq 182 aa
MVTLSKTGKSGQKFIARNRAPRVQIEYDVEIYGSEKKVQIPFVMGVMADLSGKPVDPLPE
IADRKFLDIDIDNFDARMKSIKPRASFNVPNTLTGDGRLHIDLTFESMDDFSPASIARKV
GALNSLLEARTQLHNLLSYMDGKQGAEELIGKVLKDPALLKSLAAMPNRPAGGVTEKTDD
AQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atggtgaccttaagcaagaccggcaagagcggtcagaagttcattgcccgcaaccgggcc
ccgcgcgtgcagatcgagtacgacgtcgagatctacggctccgagaagaaggtgcagatt
cccttcgtcatgggcgtgatggcggacctctcgggcaagccggtggatcccctgccggag
atcgcggaccgcaagttcctcgacatcgacatcgacaacttcgatgcccgcatgaagtcg
atcaagccgcgtgcctcgttcaacgtgcccaacacgctgacgggcgacggccgcctgcac
atcgacctgacgttcgagagcatggacgacttctctcccgcctcgatcgcgcgcaaggtg
ggcgccctcaactccctgctggaagcccgcacccagttgcacaacctgctgtcgtacatg
gacggcaagcagggcgcggaggaactgatcggcaaggtgctgaaggacccggcgctgctc
aagtcgctggccgcgatgcccaaccggcccgccggcggcgtgaccgagaagaccgacgac
gctcagtga

DBGET integrated database retrieval system