KEGG   Acidovorax avenae: Acav_1518
Entry
Acav_1518         CDS       T01445                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aaa02044]
    Acav_1518
Secretion system [BR:aaa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acav_1518
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ADX45440
UniProt: F0Q338
Position
1692555..1693076
AA seq 173 aa
MATQGREKYGHGKDRLQPALLDRLTDHEPSRRTERAEAVYVTEARLRQALLRDLNWLLNA
SDASSHIDFEGLTHAERSVLNFGMKPLAGQLLSELDWKDVEAAILKSILQHEPRILPHTL
SVTLAPSSKLFNHHNTLQFEIRCQFWSSPYPLELLLKTSLDLETGQVSVSEQR
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcgacgcagggcagggagaagtacggacacggcaaggaccgcctgcagccggcgctg
ctggaccggctgaccgaccatgagccctcccggcgcacggagcgggccgaggcggtgtat
gtgaccgaggcgcgcctgcggcaggcgctgctgcgcgacctgaactggctgctgaacgcg
tcggacgcgtcgtcgcacatcgatttcgagggcctgacccacgccgaacggtccgtgctg
aacttcggcatgaaaccgctggccggccaactgctgtcggagctggactggaaggacgtg
gaagcggccatcctgaagtcgatcctccagcacgaaccccgcatcctgccccataccctg
agcgtgacgctggctccctccagcaagctgttcaaccaccacaacaccctgcagttcgaa
atccggtgccagttctggtcatcgccctatccgctggagctgctgctcaagaccagcctc
gacctggagaccgggcaggtgtccgtgtccgagcagcggtga

DBGET integrated database retrieval system