KEGG   Acidovorax avenae: Acav_2001Help
Entry
Acav_2001         CDS       T01445                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aaa  Acidovorax avenae
Pathway
aaa00020  Citrate cycle (TCA cycle)
aaa00310  Lysine degradation
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
Module
aaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acav_2001
  Amino acid metabolism
   00310 Lysine degradation
    Acav_2001
Enzymes [BR:aaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acav_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADX45915
UniProt: F0Q8Y4
Position
2231030..2232307
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLSWKKKAGEAVAIDEILIEIETDKVVLEVPAPAAGVLAEI
VQGDGATVVADQVIARIDTEGKAGAAAPAQSAPTAAAQAPAVAAAAADAAPAGGSKGDVA
MPAAAKLLADNNLSVSAVSGSGKDGRVTKGDVLAAVAGGAAAKPSAAPAAIPTGVPTKAL
PQVASPAAPNLGDRPEQRVPMSRLRARIAERLLQSQSTNAILTTFNEVNMAPVMELRKKF
QDSFTKEHGTKLGFMSFFVKAAVHALKKFPVLNASVDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQMSFADIEKKIAEFGKKAQEGKLGIEEMTGGTFSISNGGTFGSMLSTPIINP
PQSAILGVHATKDRAVVENGQIVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPAR
LLFDI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccaactgtccgaatccgtggccgaggccacgatg
ctctcctggaagaagaaggccggcgaggccgtcgccatcgatgagatcctgatcgagatc
gagaccgacaaggtcgtgctcgaagtgcccgcgccggccgccggcgtgctggccgagatc
gtccagggcgacggtgccaccgtcgtggccgaccaggtcatcgccaggatcgacaccgaa
ggcaaggccggcgccgccgcgcccgctcagtccgctccgaccgccgccgcccaggcgccc
gccgtggccgccgcagcggccgacgccgcccctgcaggcggttcgaagggcgacgtggcc
atgccggccgccgccaagctgctggccgacaacaacctgtccgtgtcggccgtgtccggc
tccggcaaggatggccgcgtgaccaagggcgacgtgctggccgccgtggccggtggcgct
gccgccaagccgtccgctgcccccgccgccatccccacgggcgtgcccaccaaggcgctg
ccgcaggtggcatcccccgccgcaccgaacctgggcgaccgccccgagcagcgcgtgccg
atgagccgcctgcgcgcccgcatcgccgagcgcctgctgcagtcgcagtccaccaacgcc
atcctgaccaccttcaacgaggtgaacatggccccggtgatggagctgcgcaagaagttc
caggacagcttcaccaaggagcacggcaccaagctgggcttcatgagcttcttcgtgaag
gcggccgtgcacgcgctcaagaagttcccggtgctgaacgcttcggtggacggcaacgac
atcgtttatcacggctacttcgacatcggcatcgccgtcggctcgccccgcggcctggtg
gtgccgatcctgcgcaacgccgaccagatgagcttcgccgacatcgagaagaagatcgcc
gagttcggcaagaaggcccaggaaggcaagctcggcatcgaggagatgacgggcggcacg
ttctcgatctccaatggcggcaccttcggttccatgttgtccacccccatcatcaacccg
ccccagtcggccatcctgggcgtgcacgccaccaaggaccgtgccgtggtggaaaacggc
cagatcgtggtgcgcccgatgaactacctggcgatgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgggcctggtggcgatgaaggacgcgctggaagatccggcccgc
ctgctgttcgatatttga

DBGET integrated database retrieval system