KEGG   Acidovorax avenae: Acav_2103Help
Entry
Acav_2103         CDS       T01445                                 

Definition
(GenBank) Protein of unknown function DUF2257
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2OG-Fe_Oxy_2
Motif
Other DBs
NCBI-ProteinID: ADX46015
UniProt: F0Q9V0
Position
2346312..2347103
Genome map
AA seq 263 aa AA seqDB search
MAHITFPPPYLRPEQVADHLRSTGYAVLRPEDTAAWIGVPLAALQALHADWPSLPPDEFL
KDGGRYRRRRHSCFVADESGLRQVPHRAHWQPLDYNALHGGMQRWFAPMQDATVAQPAWQ
QLLAALAGLSQQALADAPARWFLEAHQFRIDTTDGIGRPTPEGAHRDGVDLVAVFLVGRE
GVKGGETRIFEAAGPSGHRFTLSEPWSLMLLDDARMIHETTPIQPLGDAPGYRDTLVVTC
RRGGFQEEGGDKAGDKAATTPAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacatcacgtttccccctccctacctgcggcccgaacaggtcgccgaccacctg
cgcagcacgggctacgccgtgctgcggcccgaggacaccgctgcctggatcggcgtgccg
ctcgcggcgctgcaggcgctgcatgcggactggccctcgctgccgcccgatgaattcctc
aaggatggcggacgctaccgccggcggcggcattcctgcttcgtggccgacgagtccgga
ctgcggcaggtgccccaccgcgcccactggcagccgctggactacaacgccctgcatggc
ggaatgcagcgctggttcgcgcccatgcaggatgcgaccgtggcgcagcctgcctggcag
caattgctggctgcgctggccggcctgtcgcagcaggcgctggcggacgccccggcgcgc
tggttcctggaggcccaccagttccgtatcgacaccaccgacggcatcgggcggcccacg
cccgagggcgcgcaccgcgacggcgtggacctcgtggccgtgttcctggtggggcgcgag
ggggtgaagggcggcgagacccgcatcttcgaggcggccggccccagcggccaccgcttc
accctcagcgagccctggtcgctcatgctgctggacgatgcccgcatgatccacgagacc
acgcccatccagcccctgggggatgcgccgggctaccgcgacacgctggtggtgacctgc
cggcgcggcgggttccaggaagagggcggggacaaggcgggggacaaggccgcaacaacc
cctgctgcttga

DBGET integrated database retrieval system