KEGG   Acidovorax avenae: Acav_2111Help
Entry
Acav_2111         CDS       T01445                                 

Definition
(GenBank) PAS/PAC sensor hybrid histidine kinase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg PAS_8 HisKA PAS PAS_4 PAS_9 PAS_10 HATPase_c_2 PAS_7
Motif
Other DBs
NCBI-ProteinID: ADX46023
UniProt: F0Q9V8
Position
complement(2354265..2356517)
Genome map
AA seq 750 aa AA seqDB search
MSRPDLSFLLPPDPEDDRGAASGGEPAGTAGEPAVPSGEGGGHRRQPPHPEGPVAALIAE
LRAYQAELEVQNKVLRYSQTAAESASERFETLFASVPLALMVLDEHDMVVQANSMAHRWF
QPTESDRPLTSLMPFVSAADAARVRATFEQARDHGHGEASEVLFPIGDGDAGITGDLYIA
RIEAPQADGAPEQWQFLCAVVDQGPLVAERRALQHSATALQERNAQLYASERRLEAVINS
ALDAIICVDQNQRITVFNPTAAALFQCATADALGSPLDRFLPDAVQALAFAQLATQAVLG
EMVALTASGKELAVEVSVSFERHAEGETTTVFARDLTGRKKAEAHRNELEAQLRESHKMQ
AVGTMAGGIAHDFNNILSAILGNVELAKADCAAGSPVLESLREIEKAGRRARDLVRQILT
FSRNEPPRRTAVPVAEAIHDTERLLRVTLPPAIELRLHLDRDLPALLADATQVEQALLNL
CTNAIHALGDARGTVCVEASAMQPDHRLCERLALPPGEYVAISVVDNGPGIDAATQLRIF
EPFFTTKPVGQGTGLGLAVVHGVMRTHGGAVDVQSAPGEGSRFTLYFPAAEAEAAPAPAA
APAGDTAPAAGAASPAAPAAGVPDERQRHVMYVDDDQALVFLVQRLLRRRGYRVTGFTDP
REAAVALGADPQAYDLVVTDYNMPGYCGVDLVREAKRIRADLPVALASGHVTAEIERDAL
AEGASALIHKPNDVDELCATVDRLVHGGPA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccccgacctgtccttcctgctgccacccgacccggaggatgaccgcggggcc
gcgtccggcggcgagcctgcgggcacggccggcgagcccgccgtgccgtccggcgagggc
ggcggccaccgccgccagccgccccacccggaaggccccgtggccgcgctcatcgcggaa
ctgcgcgcctaccaggccgagctggaggtgcagaacaaggtgctgcgctacagccagacc
gccgcggagagcgcatccgaacgattcgagacgctgttcgccagcgtgccgctggcgctc
atggtgctggacgagcacgacatggtggtgcaggccaattcgatggcgcaccgctggttc
cagcccaccgagtccgaccgccccctgacctcgctcatgcccttcgtcagcgcggcggat
gccgcccgcgtgcgcgccacgttcgagcaggcccgggaccatgggcacggcgaggccagc
gaggtgctgttccccatcggcgacggagacgcgggcatcacgggcgacctgtacatcgcg
cgcatcgaggccccccaggccgatggcgcaccggagcagtggcagttcctctgcgccgtg
gtggaccagggcccgctggtggccgagcgccgcgcactgcagcacagcgccacggccctg
caggagcgcaacgcccagctgtacgccagcgagcgccgcctggaggccgtcatcaactcc
gcgctggacgccatcatctgcgtggaccagaaccagcgcatcaccgtcttcaaccccacg
gccgcagccctgttccagtgcgccacggccgacgcgctgggcagcccgctcgaccgcttc
ctgcccgatgccgtccaggccctggccttcgcccagctggccacccaggccgtgctcggc
gagatggtggcgctcaccgccagcggcaaggagctggcggtggaggtgagcgtgtccttc
gagcggcatgccgagggcgagaccaccaccgtgttcgcacgcgacctcaccggccgcaag
aaggccgaggcgcaccgcaacgaactggaggcgcagctgcgcgaatcccacaagatgcag
gccgtgggcaccatggccggcgggatcgcgcacgacttcaacaacatcctgagcgccatc
ctcggcaacgtggaactggccaaggcggactgcgctgccggctcaccggtgctggagagc
ctgcgggagatcgagaaggccggccggcgcgcgcgcgacctcgtccggcagatcctcacc
ttcagccgcaacgagccgccccggcgcaccgccgtgccggtggccgaggccatccacgac
accgagcgcctgctgcgcgtgaccctgccgccggccatcgagttgcgcctgcacctggac
cgcgatctgcccgccctgctggccgatgccacccaggtggagcaggccctgctgaacctg
tgcacgaatgccatccatgcccttggcgatgcgcgcggcacggtgtgcgtggaggcgtcg
gccatgcagcccgaccaccgcctgtgcgagcgcctcgcactgccgcccggcgagtacgtg
gccatcagcgtggtggacaacggccccggcatcgatgccgccacgcagctgcgcatcttc
gagccgttcttcaccaccaagcccgtcggccagggcacgggactgggactggccgtggtg
cacggcgtgatgcgcacccacggcggcgcggtggacgtgcagagcgcgcccggcgagggc
agccgcttcacactgtatttcccggcggcggaggccgaagccgcaccggcgccagccgcc
gcgcccgcgggcgataccgcaccggcggccggggcggccagccccgccgcgcctgccgca
ggcgtgcccgacgaacgccagcgccacgtgatgtacgtggacgacgaccaggccctggtc
ttcctcgtgcagcgcctgctgcgccgccgcggctaccgcgtgaccggattcacggacccg
cgcgaggccgccgtggcgctgggcgcggacccgcaggcctacgatctggtcgtgaccgac
tacaacatgcccggctactgcggcgtggacctggtgcgcgaggccaagcgcatccgcgcc
gacctgcccgtggcgctcgcctcggggcacgtgacggcggagatcgagcgcgatgcgctg
gccgaaggcgcgagcgcgctgatccacaagcccaacgatgtggacgagctgtgcgccacg
gtggaccgcctggtccacggcggtccggcgtga

DBGET integrated database retrieval system