KEGG   Acidovorax avenae: Acav_2112Help
Entry
Acav_2112         CDS       T01445                                 

Definition
(GenBank) protein of unknown function DUF894 DitE
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_3 MFS_1
Motif
Other DBs
NCBI-ProteinID: ADX46024
UniProt: F0QAI3
Position
complement(2356654..2357955)
Genome map
AA seq 433 aa AA seqDB search
MATESNSPSSAPLPPGTPLSRNAGFRWLTASSALSLLGDQFSLIAMPWLVLQTTDDTRVL
GTVLALMSVPRAVFILVGGAIVDRHSPLRVLRLTRWLNAALTGLLAALVLAGHCPLWALY
ALSLALGISTAFSIPAATSITPRVVGRAQLHAANSIGMGLRQVGMSVGPLLAGLLIAGFG
GAGTKAADRTGIGFAFAVDALSFVVSAWMLGRVRLHAPAPGAVPGGGAVLAAVAQGLSHA
WRDRPLRTCFLYWGLLSILVMGPTQIALPVLTHGQPQLGAAAFGILVGMHGAGTLAGMVA
AGALPRLRLVNLGTTLLAVDAVAGLLIAPLGSISAVWQGALLLGSVGLLGGFMQVGLFTW
IQQRVPPALLGRTMGLFMFIFMGLQPVAAAATGWLLQVVPPGRLFLLCGGTLVLLAALAA
VATPMRRMQDAAP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaatcgaattccccatcctccgcgcccctgccgcccggcacgccgctgtcg
cgcaacgccggcttccgctggctcacggccagctcggcgctgtccttgctgggtgaccag
ttctcgctgatcgccatgccctggctggtgctgcagaccacggacgacacgcgcgtgctg
ggcaccgtgctggccctcatgagcgtgccccgcgccgtcttcatcctcgtgggcggtgcc
atcgtggaccggcattcgccgctgcgggtgctgcgcctgacgcgctggctgaacgccgcg
ctgaccgggctgctggccgcactggtactggcaggccactgcccgctctgggcgctctac
gcgctgtcgctggcgctcggtatctccaccgcgttcagcatcccggccgctacctccatc
acgccgcgcgtggtgggccgggcgcagttgcatgcggccaacagcatcggcatgggattg
cggcaggtcggcatgtccgtgggcccgctgctcgccggcctgctgatcgcgggcttcggc
ggcgcgggcacgaaggcggcggaccgcacggggatcggcttcgccttcgcggtggacgcg
ctcagcttcgtggtgtccgcatggatgctcggccgggtgcggctgcatgcacccgcgcct
ggagcggttccgggcgggggcgcggtgctggcggccgtcgcccagggtctttcccatgcc
tggcgcgaccggccgctgcgcacctgcttcctgtactgggggctgctgtcgatcctggtg
atgggaccgacgcagatcgccctgcccgtgctcacccacggccagccgcagctcggcgcc
gccgcgttcggcatcctggtgggcatgcacggcgcgggcacgctggcgggcatggtggca
gcgggcgcgcttccgcgcctgcggctcgtcaacctgggcaccaccctgctggcggtggat
gccgtggcgggcctgctgatcgcgccgctgggaagcatctcggcagtctggcagggggct
ctgctcctgggcagcgtgggcctgctgggcggtttcatgcaggtcggattgttcacgtgg
atccagcagcgcgtgccgcccgcgctcctcgggcgcaccatgggcctgttcatgttcatt
ttcatgggcctgcagccggtggccgcggcggcgacgggctggctgctgcaggtcgtgccg
ccgggccggctcttcctgctctgcggcggcaccctggtgctgctggccgccctggcggcg
gtggccacgccgatgcgccgcatgcaggacgccgcgccctga

DBGET integrated database retrieval system