KEGG   Acidovorax avenae: Acav_2115Help
Entry
Acav_2115         CDS       T01445                                 

Definition
(GenBank) glycine dehydrogenase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
aaa  Acidovorax avenae
Pathway
aaa00260  Glycine, serine and threonine metabolism
aaa00630  Glyoxylate and dicarboxylate metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acav_2115
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acav_2115
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Acav_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADX46027
UniProt: F0QAI6
Position
complement(2359596..2362562)
Genome map
AA seq 988 aa AA seqDB search
MPTPTFPPLGALENAAEFQPRHIGIDAADEQRMLSAIGEASRAALVESIVPRSIARTAPM
ELPPATTEAVALAELKAIASKNRVLRSFIGQGYYGTHTPGVILRNILENPAWYTAYTPYQ
AEISQGRMEALVNFQTMVCDLTGMPIANASMLDEATAAAEAMTLAKRSVKSKSQTLVVSG
DTHPQTIEVIRTRAEPLGITVVVADSEAEWNAAIEGDFFAAVIQYPASSGWLADWSADVE
KIHAKQAAAIVCADLLALTLLVPPGEWGADIVVGSTQRFGMPMGAGGPHAAFMACRDDFK
RSLPGRLVGVSVDAHGQPAYRLALQTREQHIRREKATSNICTAQVLPAVIASMYAVYHGP
EGLKRIAQRVASFTAILAKGLVALGHTAHHHESAFDTLCLHTKEQTGALLARAVERGANL
RVAWNDYLCISLDETTTRADIELLWSIFATDGQALPRIEDFADGVNPLIPAELLRKSAFL
THPVFNTHHSETGMLRYIRQLSDKDLALDRSMIPLGSCTMKLNATSEMIPITWPEFAQVH
PFAPADQLEGYRQLDEQLRAWLCQATGYAGISLQPNAGSQGEYAGLLAIRAYHAAQGQGH
RNICLIPSSAHGTNPASAQMVGMQVVVTACDANGNVDMDDLRAKCEQHAEKLACVMITYP
STHGVFETQVKELCQLVHRHGGRVYVDGANMNAMVGVAAPGAFGGDVSHLNLHKTFCIPH
GGGGPGVGPVCVVEDLVPYLPGHATAGAQGALEPAPGRPKLAKAPLGGSEPHAVGSVGAV
SAAPLGNAAVLPISWMYIRMMGPDGLRAATETAILSANYISARLKDHYPTLYASANGHVA
HECILDLRGFKETSGVMAEDVAKRLIDYGFHAPTLSFPVPNTLMVEPTESETLAELDRFI
DAMIAIRGEIRRIEQGEWPQDDNPLKNAPHTAHSLLGGEWTHPYPREAAAYPVAALRQAK
YWSPVGRVDNVYGDRNLFCSCVPVSDFA
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgcccaccttcccgccgcttggcgcgcttgaaaacgccgccgaattccagccc
cgccacatcggcatcgatgccgcggacgaacagcgcatgctctcggccatcggcgaggcc
tcgcgcgcggcgctggtggagagcatcgtgccgcgctccatcgcccgcactgcgccgatg
gagttgccgcccgccacgaccgaggcggtggcgctcgcggaactcaaggccatcgcctcg
aagaaccgcgtgctgcgcagcttcatcggccagggttactacggcacgcacacgccgggc
gtgatcctgcgcaacatcctggaaaaccccgcctggtacaccgcctacacgccctaccag
gccgagatctcgcagggccgcatggaggccctggtcaacttccagacgatggtgtgcgac
ctcacgggcatgcccatcgccaacgcctcgatgctggacgaagccacggccgcggccgag
gccatgacactcgccaagcgctccgtcaagtcgaagagccagacgctcgtcgtctcgggc
gacacgcatccgcagaccatcgaggtgatccgcacgcgtgccgaacccctgggcatcacg
gtggtggtggcggactccgaggccgaatggaacgccgcgatcgagggcgacttcttcgcc
gccgtgatccagtaccctgccagcagcggctggctcgccgactggagcgccgacgtggag
aagatccacgcgaagcaggctgccgcgatcgtgtgcgccgatctgctggcgctcacgctg
ctggtgccgcccggcgaatggggcgcggacatcgtcgtgggcagcacgcagcgcttcggc
atgccgatgggcgcgggtggcccgcatgccgccttcatggcctgccgcgacgacttcaag
cgctcgctgcccggccgcctcgtgggcgtgagcgtggacgcgcacggccagccggcctac
cgcctcgcgctgcagacgcgcgagcagcacatccgccgcgagaaggccacctccaacatc
tgcacggcgcaggtgctgccggcggtgatcgccagcatgtatgccgtctaccacgggccc
gaaggcctcaagcgcatcgcacagcgcgtggcgagcttcacggccatcctggccaagggc
ctcgtggcgctcggccataccgcgcaccaccacgagtcggccttcgacacgctgtgcctg
cacacgaaagagcagaccggcgcgctgctggcgcgcgccgtggagcgcggcgccaacctg
cgcgtggcctggaacgactacctctgcatctcgctcgacgaaaccacgacccgggccgac
atcgaactgctctggtcgatcttcgccaccgacgggcaggccctgccccgcatcgaggat
ttcgcggatggcgtgaacccgctgatccctgcagaactgcttcgcaagagcgccttcctc
acgcacccggtgttcaacacccaccattccgagacgggcatgctgcgctacatccgccag
ctctcggacaaggacctggcgctcgaccgcagcatgatcccgctgggcagctgcaccatg
aagctgaacgccacgagcgagatgatcccgatcacctggccggaattcgcgcaggtgcac
ccgttcgcgcccgccgaccagctggaaggctaccgccagctcgacgagcaactgcgcgcc
tggctctgccaggccacgggctacgccggcatcagcctgcagcccaacgccgggtcgcag
ggcgaatacgcgggcctgctggccatccgtgcctaccatgcggcgcagggccagggccac
cgcaacatctgcctgatcccgagcagcgcgcacggcaccaacccggccagcgcccagatg
gtgggcatgcaggtggtggtgacggcctgcgatgcgaacggcaacgtcgacatggacgac
ctgcgcgccaagtgcgagcagcatgccgagaagctcgcctgcgtgatgatcacctacccc
agcacgcacggcgtgttcgagacgcaggtgaaggaactctgccagctcgtgcaccgccac
ggcggccgcgtgtacgtggacggcgccaacatgaacgccatggtgggcgtggccgcgccc
ggcgccttcggcggcgacgtgagccacctgaacctgcacaagaccttctgcatcccgcac
ggcggcggcggccccggcgtcggccccgtctgcgtggtggaagacctcgtgccctacctg
ccgggccatgccactgctggcgcacaaggtgcgcttgagccagcgccgggccgccccaag
ctggcgaaggcccccctggggggcagcgaaccacacgcagtgggtagcgtgggggctgtc
agtgccgccccgctgggcaatgccgcggtgctgccgatcagttggatgtacatccgcatg
atgggcccggacggcctgcgcgccgccaccgagacggccatcctctcggccaactacatc
agcgcgcgcctgaaggaccactatcccacgctgtacgcgagcgccaacggccatgtggcg
cacgagtgcatcctggacctgcgcggcttcaaggagaccagcggcgtgatggccgaggac
gtcgccaagcggctgatcgactacggcttccacgcgcccacgctctccttccccgtgccc
aacacgctcatggtggagcccaccgaaagcgagacgctggccgagctggaccgcttcatc
gacgcgatgatcgccatccgcggcgagatccgccgcatcgagcagggcgagtggccgcag
gacgacaacccgctcaagaacgcgccccacaccgcgcacagcctgctgggcggcgagtgg
acgcatccctacccgcgcgaggcggcggcctatccggtcgcggcgctgcggcaggccaag
tactggtcgcccgtgggccgggtggacaacgtctacggcgaccgcaacctgttctgcagc
tgcgtgccggtgtccgacttcgcgtga

DBGET integrated database retrieval system