KEGG   Acidovorax avenae: Acav_2118Help
Entry
Acav_2118         CDS       T01445                                 

Definition
(GenBank) transcriptional regulator, AsnC family
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aaa03000]
    Acav_2118
   03036 Chromosome and associated proteins [BR:aaa03036]
    Acav_2118
Transcription factors [BR:aaa03000]
 Prokaryotic Type
  Helix-turn-helix
   Lrp/AsnC family
    Acav_2118
Chromosome and associated proteins [BR:aaa03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Acav_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsnC_trans_reg HTH_AsnC-type HTH_24 HTH_20 MarR_2 HTH_23 HTH_11 P2 LexA_DNA_bind HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: ADX46030
UniProt: F0QAI9
Position
2364827..2365285
Genome map
AA seq 152 aa AA seqDB search
MDRIDRRILAVLQADARASLQEIGQAVGLSPSPCWGRIRKMEEAGVIEGYTVRLNAQALD
LADTVLVQVTLDSHSDNTLEKFGETLASIPEVIEAHLVSGDYDYLLRVVVKDTRDYERLL
REKLYRIKGIRHSRSSFVLRTLKKADLPLRTD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcatcgaccgaagaatcctggccgtcctgcaggccgacgcgcgcgcgagcctg
caggaaatcgggcaggccgtgggcctgagcccatcgccgtgctggggccgcatccgcaag
atggaagaggccggcgtgatcgagggctacaccgtgcgcctcaacgcccaggcgctcgac
ctggccgataccgtgctcgtgcaggtcacgctcgacagccattccgacaacaccctggag
aagttcggcgaaacgctcgcgagcattcccgaggtgatcgaggcgcacctcgtctccggc
gactacgactacctgctgcgcgtggtggtcaaggacacgcgcgactacgagcgcctgctg
cgcgagaagctctaccgcatcaagggcattcgccacagccgctccagcttcgtgctgcgc
acgctcaagaaggccgatctgccgctgcgcacggactga

DBGET integrated database retrieval system